Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  E3 ubiquitin-protein ligase TRIM32  

UniProtKB / Swiss-Prot ID :  TRI32_MOUSE

Gene Name (Synonyms) : 
Trim32  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm. Note=Localized in cytoplasmic bodies, usually concentrated around the nucleus. 

Protein Function :  Has an E3 ubiquitin ligase activity. Ubiquitinates DTNBP1 (dysbindin) (By similarity). Ubiquitinates PIAS4/PIASY and promotes its degradation in keratinocytes treated with UVB and TNF-alpha. 

Protein Sequence MAAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITR...
Predicted Secondary Structure CCCCCCCCCCCHHHHHHHCCCCCCCHHHCCCCCCCEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
8PhosphoserineAAAASHLNL
CCCCCCCCH
24.63Phosphositeplus
Link-
330PhosphoserineEMDMSPEEV
EEEEECCCC
25.54Phosphositeplus
Link-
337PhosphoserineEVAPSPRAS
CCCCCCCCC
19.79Phosphositeplus
Link-
341PhosphoserineSPRASPAKQ
CCCCCCCCC
27.03Phosphositeplus
Link-
347PhosphoserineAKQRSSEAA
CCCCCCCCC
30.00Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures