Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  tRNA (guanine-N(7)-)-methyltransferase  

UniProtKB / Swiss-Prot ID :  TRMB_HUMAN

Gene Name (Synonyms) : 
METTL1, C12orf1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus. 

Protein Function :  Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. 

Protein Sequence MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKK...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCEEECCCHHHHHHHHHHCCCCCCHHHHHHHCCHHCCCCCCCCCCCCCCCHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAETR
---CCCCCC
17.63UniProtKB
Link-
18Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PPPQKRYYR
CCCCCCCEE
48.41Phosphositeplus
Link-
27PhosphoserineQRAHSNPMA
ECCCHHHHH
41.46Phosphositeplus
Link-
27Phosphoserine (AKT1)QRAHSNPMA
ECCCHHHHH
41.46HPRD
Link-
27Phosphoserine (RPS6KA1)QRAHSNPMA
ECCCHHHHH
41.46HPRD
Link-
27Phosphoserine; by PKB and RPS6KA3.QRAHSNPMA
ECCCHHHHH
41.46UniProtKB
Link-
242Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TEEGKKVLR
CHHHHHHHH
42.88Phosphositeplus
Link
250Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RNGGKNFPA
HCCCCEEEE
57.73Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
WDR4_HUMANphysical interactionEBI-758215
intact16189514
WDR4_HUMANin vivo
yeast 2-hybrid
HPRD:06834HPRD15861136
16189514
WDR4_HUMANENSP00000314441STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"The tRNA methylase METTL1 is phosphorylated and inactivated by PKBand RSK in vitro and in cells.";
Cartlidge R.A., Knebel A., Peggie M., Alexandrov A., Phizicky E.M.,Cohen P.;
EMBO J. 24:1696-1705(2005).
Cited for: SUBCELLULAR LOCATION, INTERACTION WITH WDR4, PHOSPHORYLATION ATSER-27, AND MUTAGENESIS OF SER-27.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures