Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Tumor susceptibility gene 101 protein  

UniProtKB / Swiss-Prot ID :  TS101_HUMAN

Gene Name (Synonyms) : 
TSG101  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Membrane; Peripheral membrane protein. Nucleus. Late endosome membrane; Peripheral membrane protein. Note=Mainly cytoplasmic. Membrane-associated when active and soluble when inactive. Depending on the stage of the cell cycle, detected in the  

Protein Function :  Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. 

Protein Sequence MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNI...
Predicted Secondary Structure CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEECCCCHHHHHHHHCCCEEEECCCEECC...
Protein Variant
LocationDescription
167M -> I (in dbSNP:rs34385327). VAR_034572
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAVSES
---CCCCHH
17.34UniProtKB
Link
90N6-acetyllysineICFVKPTSS
EEEEECCCC
23.48Phosphositeplus
Link
220PhosphothreonineSRDGTISED
CCCCCCCHH
26.14HPRD
Link-
220PhosphothreonineSRDGTISED
CCCCCCCHH
26.14Phosphositeplus
Link-
220Phosphothreonine.SRDGTISED
CCCCCCCHH
26.14UniProtKB
Link-
237Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AVSDKLRWR
HHHHHHHHH
32.23Phosphositeplus
Link-
257Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LNALKRTEE
HHHHHCCHH
55.66Phosphositeplus
Link-
299PhosphoserineDEELSSALE
HHHHHHHHH
19.49HPRD
Link-
299PhosphoserineDEELSSALE
HHHHHHHHH
19.49Phosphositeplus
Link-
300PhosphoserineEELSSALEK
HHHHHHHHH
49.88HPRD
Link-
300PhosphoserineEELSSALEK
HHHHHHHHH
49.88Phosphositeplus
Link-
361Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DVFLKHVRL
HHHHHHHHH
28.70Phosphositeplus
Link-
390PhosphotyrosineLSDLY
CCCCC
22.84HPRD
Link
390PhosphotyrosineLSDLY
CCCCC
22.84PhosphoELM
Link
390PhosphotyrosineLSDLY
CCCCC
22.84Phosphositeplus
Link
390Phosphotyrosine.LSDLY
CCCCC
22.84UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
Q86VK0_HUMANphysical interactionMINT-68469MINT16189514
LIPB2_HUMANphysical interactionMINT-66433MINT16189514
PDC6I_HUMANphysical interactionEBI-1221854
intact17350572
LIPB2_HUMANphysical interactionEBI-753766
intact16189514
LRSM1_HUMANphysical interactionEBI-754159
intact16189514
CEP55_HUMANphysical interactionEBI-758152
intact16189514
VPS28_HUMANphysical interactionEBI-760417
intact16189514
HGS_HUMANphysical interactionEBI-760432
intact16189514
UBIQ_HUMANdirect interactionEBI-1038470
intact15053872
HCK_HUMANphysical interactionEBI-346902
intact12029088
CDN1A_HUMANin vivo
yeast 2-hybrid
HPRD:03229HPRD11943869
DNMT1_HUMANin vivo
yeast 2-hybrid
HPRD:03229HPRD10888872
GCR_HUMANyeast 2-hybridHPRD:03229HPRD10508170
HCK_HUMANin vitroHPRD:03229HPRD12029088
LIPB2_HUMANyeast 2-hybridHPRD:03229HPRD16189514
CEP55_HUMANyeast 2-hybridHPRD:03229HPRD16189514
MDM2_HUMANin vivoHPRD:03229HPRD11172000
P53_HUMANin vivoHPRD:03229HPRD11172000
ANDR_HUMANin vitro
yeast 2-hybrid
HPRD:03229HPRD10508170
AATF_HUMANENSP00000251968STRING
CDN1A_HUMANENSP00000251968STRING
VPS4A_HUMANENSP00000251968STRING
MDM2_HUMANENSP00000251968STRING
FA11_HUMANENSP00000251968STRING
DAXX_HUMANENSP00000251968STRING
P53_HUMANENSP00000251968STRING
VPS28_HUMANENSP00000251968STRING
PDC6I_HUMANENSP00000251968STRING
DMAP1_HUMANENSP00000251968STRING
HGS_HUMANENSP00000251968STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer.";
Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.;
Cell 131:1190-1203(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-390, AND MASSSPECTROMETRY.
"Evaluation of the low-specificity protease elastase for large-scalephosphoproteome analysis.";
Wang B., Malik R., Nigg E.A., Korner R.;
Anal. Chem. 80:9526-9533(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-220, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures