Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  NEDD8-activating enzyme E1 catalytic subunit  

UniProtKB / Swiss-Prot ID :  UBA3_HUMAN

Gene Name (Synonyms) : 
UBA3, UBE1C  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Catalytic subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. Down-regulates steroid receptor activity. Necessary for cell cycle progression. 

Protein Sequence MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTC...
Predicted Secondary Structure CCCCCCHHHHHHHHHHHHHHHEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHCC...
Protein Variant
LocationDescription
9K -> R (in dbSNP:rs17852113). VAR_023945
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
86Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)CELLKNLAL
HHHHHHHHH
63.64Phosphositeplus
Link
91PhosphoserineNLALSGFRQ
HHHHHCCCE
30.22HPRD
Link
91PhosphoserineNLALSGFRQ
HHHHHCCCE
30.22Phosphositeplus
Link
103PhosphothreonineIDMDTIDVS
EECCEECCC
16.67Phosphositeplus
Link
107PhosphoserineTIDVSNLNR
EECCCCCCC
31.67Phosphositeplus
Link
147Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PHFNKIQDF
EEECCCCCC
40.58Phosphositeplus
Link
260Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LQWPKEQPF
HHHHHHCCC
67.05Phosphositeplus
Link
284Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WIFQKSLER
HHHHHHHHH
46.38Phosphositeplus
Link
307Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QGVVKRIIP
HHHHHHHHH
35.16Phosphositeplus
Link
361Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EAERKENCP
CCCCCCCCC
44.79Phosphositeplus
Link
390PhosphothreonineLDYLTNSAS
HHHHHHHCC
22.39HPRD
Link
390PhosphothreonineLDYLTNSAS
HHHHHHHCC
22.39SysPTM
Link
398Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SLQMKSPAI
CCCCCCHHH
40.08Phosphositeplus
Link
399PhosphoserineLQMKSPAIT
CCCCCHHHH
17.77HPRD
Link
399PhosphoserineLQMKSPAIT
CCCCCHHHH
17.77Phosphositeplus
Link
409Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TLEGKNRTL
EECCCCCEE
33.60Phosphositeplus
Link
434Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SKTLKELGL
CCCEEEEEE
57.00Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
RD23A_HUMANphysical interactionMINT-2791332MINT16712842
RD23B_HUMANphysical interactionMINT-2791310MINT16712842
CHD3_HUMANphysical interactionEBI-733684
intact16169070
NEDD8_HUMANin vitro
in vivo
HPRD:04413HPRD10207026
16620772
NEDD8_HUMANENSP00000354340STRING
ULA1_HUMANENSP00000354340STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures