Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ubiquitin-conjugating enzyme E2 14  

UniProtKB / Swiss-Prot ID :  UBC14_ARATH

Gene Name (Synonyms) : 
UBC14, UBC3, UBC7 At3g55380T22E16.40  

Species :  Arabidopsis thaliana (Mouse-ear cress). 

Subcellular Localization :   

Protein Function :  Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Involved in the formation of multiubiquitin chains. Signal the protein for selective degradation. 

Protein Sequence MANNQASLLLQKQLKDLCKKPVDGFSAGLVDEKNVFQWSVSIMGPPDTLYEGGFFNAIMSFPENYPVSPP...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCEEEEEEEECCCCCCCCCCEEEEEEEECCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures