Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ubiquitin-conjugating enzyme E2 K  

UniProtKB / Swiss-Prot ID :  UBE2K_HUMAN

Gene Name (Synonyms) : 
UBE2K, HIP2, LIG  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm (By similarity). 

Protein Function :  Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, in the presence or in the absence of BRCA1-BARD1 E3 ubiquitin-protein ligase complex, catalyzes the synthesis of 'Lys-48'-linked polyubiquitin chains. Does not transfer ubiquitin directly to but elongates monoubiquitinated substrate protein. Mediates the selective degradation of short-lived and abnormal proteins, such as the endoplasmic reticulum-associated degradation (ERAD) of misfolded lumenal proteins. Ubiquitinates huntingtin. May mediate foam cell formation by the suppression of apoptosis of lipid-bearing macrophages through ubiquitination and subsequence degradation of p53/TP53. Proposed to be involved in ubiquitination and proteolytic processing of NF-kappa-B; in vitro supports ubiquitination of NFKB1. In case of infection by cytomegaloviruses may be involved in the US11-dependent degradation of MHC class I heavy chains following their export from the ER to the cytosol. In case of viral infections may be involved in the HPV E7 protein- dependent degradation of RB1. 

Protein Sequence MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNP...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MANIAV
---
19.01UniProtKB
Link
14Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)KREFKEVLK
42.00Phosphositeplus
Link
14N6-acetyllysineKREFKEVLK
42.00HPRD
Link
14N6-acetyllysineKREFKEVLK
42.00Phosphositeplus
Link
14N6-acetyllysine.KREFKEVLK
42.00UniProtKB
Link
18Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KEVLKSEET
62.08Phosphositeplus
Link
24Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EETSKNQIK
61.36Phosphositeplus
Link
61Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QLEIKIPET
42.72Phosphositeplus
Link
72Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FNPPKVRFI
47.50Phosphositeplus
Link
142Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PEMFKQTAR
45.49Phosphositeplus
Link
164Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PEYTKKIEN
51.34Phosphositeplus
Link
165Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EYTKKIENL
47.67Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-14, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures