Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ubiquitin carboxyl-terminal hydrolase 5  

UniProtKB / Swiss-Prot ID :  UBP5_HUMAN

Gene Name (Synonyms) : 
USP5, ISOT  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Cleaves linear and branched multiubiquitin polymers with a marked preference for branched polymers. Involved in unanchored 'Lys-48'-linked polyubiquitin disassembly. Binds linear and 'Lys- 63'-linked polyubiquitin with a lower affinity. Knock-down of USP5 causes the accumulation of p53/TP53 and an increase in p53/TP53 transcriptional activity because the unanchored polyubiquitin that accumulates is able to compete with ubiquitinated p53/TP53 but not with MDM2 for proteasomal recognition. 

Protein Sequence MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVERHFNKTGQRVY...
Predicted Secondary Structure CCCHHHHHHHHHCCCCCCCCCCCEEECCCEEEEECCCCCCCCEEEEHHHHHHHCHHHHHHHHHHCCCEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAELSE
---CCCHHH
26.83UniProtKB
Link-
20Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IRVPKAGDR
CCCCCCCCE
63.24Phosphositeplus
Link-
27Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DRVHKDECA
CEEECCCEE
52.98Phosphositeplus
Link-
64Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RHFNKTGQR
HHHHHCCCE
53.76Phosphositeplus
Link-
161PhosphoserineADSASRKQE
CCCCCCCCC
43.92HPRD
Link-
163Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SASRKQEVQ
CCCCCCCHH
48.60Phosphositeplus
Link-
184Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AFSLKQLDN
HHHCCCCCC
47.84Phosphositeplus
Link-
184N6-acetyllysineAFSLKQLDN
HHHCCCCCC
47.84HPRD
Link-
184N6-acetyllysineAFSLKQLDN
HHHCCCCCC
47.84Phosphositeplus
Link-
184N6-acetyllysine.AFSLKQLDN
HHHCCCCCC
47.84UniProtKB
Link-
213PhosphothreonineWLNLTDGSI
EEEEECCEE
36.92HPRD
Link-
213PhosphothreonineWLNLTDGSI
EEEEECCEE
36.92Phosphositeplus
Link-
216PhosphoserineLTDGSILCG
EECCEEECC
18.39HPRD
Link-
216PhosphoserineLTDGSILCG
EECCEEECC
18.39Phosphositeplus
Link-
318Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GVPLKPLFG
CCCCCCCCC
33.34Phosphositeplus
Link-
353Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DFQRKYVDK
HHHHHHHHH
38.55Phosphositeplus
Link-
357Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KYVDKLEKI
HHHHHHHHH
48.80Phosphositeplus
Link-
360Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DKLEKIFQN
HHHHHHCCC
60.29Phosphositeplus
Link-
389PhosphotyrosineLSGEYSKPV
HHCCCCCHH
26.06Phosphositeplus
Link-
391Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GEYSKPVPE
CCCCCHHHH
49.48Phosphositeplus
Link-
406Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VPEQKEVQD
HHHHHCCCC
59.18Phosphositeplus
Link-
418Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PRMFKALIG
CHHHHHHHH
32.70Phosphositeplus
Link-
423Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ALIGKGHPE
HHHHHHHHH
47.23Phosphositeplus
Link-
468Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LVEEKIKCL
CCCCCEEEC
33.68Phosphositeplus
Link-
470Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EEKIKCLAT
CCCEEECCC
33.97Phosphositeplus
Link-
476Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LATEKVKYT
CCCCCCCCC
39.41Phosphositeplus
Link-
485PhosphotyrosineQRVDYIMQL
CCCEEEEEE
8.74HPRD
Link-
485PhosphotyrosineQRVDYIMQL
CCCEEEEEE
8.74Phosphositeplus
Link-
499Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AALNKEELL
CCCCCEEEE
54.11Phosphositeplus
Link-
505PhosphotyrosineELLEYEEKK
EEEECCCCC
29.38HPRD
Link-
505PhosphotyrosineELLEYEEKK
EEEECCCCC
29.38Phosphositeplus
Link-
558Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SVAVKTTRF
CCEEEEEEE
34.15Phosphositeplus
Link-
574Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VIQIKKFTF
EEEEEEEEE
26.01Phosphositeplus
Link-
575Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IQIKKFTFG
EEEEEEEEC
51.79Phosphositeplus
Link-
586Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WVPKKLDVS
CCCCCCCCE
43.80Phosphositeplus
Link-
623PhosphothreoninePPLVTPDEP
CCEEECCCC
32.48HPRD
Link-
623PhosphothreoninePPLVTPDEP
CCEEECCCC
32.48PhosphoELM
Link-
623PhosphothreoninePPLVTPDEP
CCEEECCCC
32.48Phosphositeplus
Link-
623PhosphothreoninePPLVTPDEP
CCEEECCCC
32.48SysPTM
Link-
623Phosphothreonine.PPLVTPDEP
CCEEECCCC
32.48UniProtKB
Link-
743Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DQALKALRA
HHHHHHHHH
48.68Phosphositeplus
Link-
767Caspase cleavage aspartic acidIDDLDAEAA
CCCCCCCCC
49.73Phosphositeplus
Link-
779PhosphoserineSEGRSAADS
CCCCCCCCC
38.37HPRD
Link-
782Caspase cleavage aspartic acidRSAADSISE
CCCCCCCCC
46.34Phosphositeplus
Link-
783PhosphoserineSAADSISES
CCCCCCCCC
24.24HPRD
Link-
783PhosphoserineSAADSISES
CCCCCCCCC
24.24PhosphoELM
Link-
783PhosphoserineSAADSISES
CCCCCCCCC
24.24Phosphositeplus
Link-
783PhosphoserineSAADSISES
CCCCCCCCC
24.24SysPTM
Link-
783PhosphoserineSAADSISES
CCCCCCCCC
24.24SysPTM
Link-
783Phosphoserine.SAADSISES
CCCCCCCCC
24.24UniProtKB
Link-
793Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PVGPKVRDG
CCCCCCCCC
43.93Phosphositeplus
Link-
836Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YNDQKVCAS
EECCEEEEE
41.99Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
TAD3L_HUMANphysical interactionMINT-68333MINT16189514
RNF11_HUMANphysical interactionMINT-60847MINT15231748
DVL2_HUMANyeast 2-hybridHPRD:03265HPRD16189514
TAD3L_HUMANyeast 2-hybridHPRD:03265HPRD16189514
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-184, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions.";
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.;
Sci. Signal. 2:RA46-RA46(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-783, AND MASSSPECTROMETRY.
"A probability-based approach for high-throughput proteinphosphorylation analysis and site localization.";
Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.;
Nat. Biotechnol. 24:1285-1292(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-623, AND MASSSPECTROMETRY.
"Improved titanium dioxide enrichment of phosphopeptides from HeLacells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.";
Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D.;
J. Proteome Res. 6:4150-4162(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-783, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures