Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ubiquilin-1  

UniProtKB / Swiss-Prot ID :  UBQL1_HUMAN

Gene Name (Synonyms) : 
UBQLN1, DA41, PLIC1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Nucleus. 

Protein Function :  Links CD47 to the cytoskeleton. Promotes the surface expression of GABA-A receptors (By similarity). Promotes the accumulation of uncleaved PSEN1 and PSEN2 by stimulating their biosynthesis. Has no effect on PSEN1 and PSEN2 degradation. 

Protein Sequence MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFK...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEECCCCHHHHHHHHHHHHHC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAESGE
---CCCCCC
21.47UniProtKB
Link-
13PhosphoserineGPPGSQDSA
CCCCCCCCC
36.27HPRD
Link-
13PhosphoserineGPPGSQDSA
CCCCCCCCC
36.27Phosphositeplus
Link-
16PhosphoserineGSQDSAAGA
CCCCCCCCC
16.63HPRD
Link-
43PhosphothreonineVTVKTPKEK
EEEECCCCE
34.94HPRD
Link-
45Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VKTPKEKEE
EECCCCEEE
83.25Phosphositeplus
Link-
47Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TPKEKEEFA
CCCCEEEEE
69.53Phosphositeplus
Link-
62Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VQQFKEEIS
HHHHHHHHH
50.53Phosphositeplus
Link-
67Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EEISKRFKS
HHHHHHHCC
68.46Phosphositeplus
Link-
70Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SKRFKSHTD
HHHHCCCHH
45.41Phosphositeplus
Link-
83Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IFAGKILKD
HHHCEEECC
41.24Phosphositeplus
Link-
269PhosphotyrosineIPGGYNALR
CCCHHHHHH
11.81HPRD
Link-
269PhosphotyrosineIPGGYNALR
CCCHHHHHH
11.81Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
SMAD9_HUMANphysical interactionMINT-62068MINT15231748
FZD7_HUMANphysical interactionMINT-66943MINT16189514
SPI2_HUMANphysical interactionMINT-67715MINT16189514
TFF1_HUMANphysical interactionMINT-66399MINT16189514
CD99_HUMANphysical interactionMINT-67309MINT16189514
DNJB2_HUMANcolocalizationMINT-4302843MINT17082820
CSTF2_HUMANphysical interactionMINT-68150MINT16189514
EP15_HUMANphysical interactionMINT-4302787MINT17082820
STCH_HUMANphysical interactionMINT-67930MINT16189514
ATX3_HUMANphysical interactionMINT-4300075MINT17082820
ATX3_HUMANcolocalizationMINT-4300171MINT17082820
PSMD4_HUMANphysical interactionMINT-4300148MINT17082820
Q5JVY0_HUMANphysical interactionMINT-66380MINT16189514
TMCO6_HUMANphysical interactionMINT-66792MINT16189514
CSTFT_HUMANphysical interactionMINT-66975MINT16189514
UBQL1_HUMANphysical interactionMINT-67197MINT16189514
UBQL1_HUMANphysical interaction
physical interaction
EBI-756271
EBI-956822
intact16189514
16713569
RIC8A_HUMANphysical interaction
physical interaction
EBI-757735
EBI-956174
intact16189514
16713569
TMCO6_HUMANphysical interactionEBI-754924
intact16189514
FBLN4_HUMANphysical interaction
physical interaction
EBI-758023
EBI-956806
intact16189514
16713569
SMCR7_HUMANphysical interactionEBI-758665
intact16189514
KLDC5_HUMANphysical interactionEBI-758698
intact16189514
GKAP1_HUMANphysical interactionEBI-956814
intact16713569
PSN1_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:05440HPRD11076969
UBQL1_HUMANyeast 2-hybridHPRD:05440HPRD16189514
16713569
SPI2_HUMANyeast 2-hybridHPRD:05440HPRD16189514
16713569
GBRD_HUMANyeast 2-hybridHPRD:05440HPRD16189514
CSTFT_HUMANyeast 2-hybridHPRD:05440HPRD16189514
RIC8A_HUMANyeast 2-hybridHPRD:05440HPRD16189514
16713569
HRSL3_HUMANyeast 2-hybridHPRD:05440HPRD16189514
KLDC5_HUMANyeast 2-hybridHPRD:05440HPRD16189514
CD47_HUMANin vitroHPRD:05440HPRD10549293
PSN2_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:05440HPRD11076969
FRAP_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:05440HPRD11853878
HES1_HUMANyeast 2-hybridHPRD:05440HPRD15492808
ACHB4_HUMANin vivoHPRD:05440HPRD16091357
ACHA3_HUMANin vivo
yeast 2-hybrid
HPRD:05440HPRD16091357
ACHA4_HUMANin vivoHPRD:05440HPRD16091357
ASCL1_HUMANyeast 2-hybridHPRD:05440HPRD15492808
PR40A_HUMANyeast 2-hybridHPRD:05440HPRD15231748
SMAD9_HUMANyeast 2-hybridHPRD:05440HPRD15231748
ZG16_HUMANyeast 2-hybridHPRD:05440HPRD16713569
UBQL4_HUMANyeast 2-hybridHPRD:05440HPRD16713569
RASF5_HUMANyeast 2-hybridHPRD:05440HPRD16713569
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures