Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ubiquilin-2  

UniProtKB / Swiss-Prot ID :  UBQL2_HUMAN

Gene Name (Synonyms) : 
UBQLN2, N4BP4, PLIC2 HRIHFB2157  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Nucleus. Note=Where it colocalizes with the proteasome. Associated with fibers in mitotic cells. 

Protein Function :  Increases the half-life of proteins destined to be degraded by the proteasome; may modulate proteasome-mediated protein degradation. 

Protein Sequence MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTD...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEECCCCHHHHHHHHHHHHHCCCHH...
Protein Variant
LocationDescription
235L -> H (in dbSNP:rs17002693). VAR_052680
497P -> H (in ALS15; leads to defectiveubiquitin-mediated proteasomal
497P -> S (in ALS15). VAR_066563
506P -> T (in ALS15; leads to defectiveubiquitin-mediated proteasomal
509P -> S (in ALS15). VAR_066565
525P -> S (in ALS15). VAR_066566
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAENGE
---CCCCCC
20.97UniProtKB
Link
34Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PKIIKVTVK
CCEEEEEEE
35.01Phosphositeplus
Link
41Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VKTPKEKEE
EECCCCEEE
83.25Phosphositeplus
Link
43Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TPKEKEEFA
CCCCEEEEE
69.53Phosphositeplus
Link
66Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SKRFKSQTD
HHHHCCCHH
45.76Phosphositeplus
Link
79Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IFAGKILKD
EECCEEECC
41.24Phosphositeplus
Link
265PhosphotyrosineIPGGYNALR
CCCHHHHHH
11.81Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
PR40A_HUMANphysical interactionMINT-61847MINT15231748
RNF11_HUMANphysical interactionMINT-60853MINT15231748
RIB1_HUMANin vitro
in vivo
HPRD:02224HPRD12200120
PR40A_HUMANyeast 2-hybridHPRD:02224HPRD15231748
UBQL4_HUMANyeast 2-hybridHPRD:02224HPRD16713569
STCH_HUMANENSP00000345195STRING
- top -

Disease Reference
Kegg disease
OMIM disease
300857Amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures