Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ubiquilin-2  

UniProtKB / Swiss-Prot ID :  UBQL2_MOUSE

Gene Name (Synonyms) : 
Ubqln2, Plic2  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm. Nucleus. Membrane. Note=Associated with fibers and membrane-associated. 

Protein Function :  Increases the half-life of proteins destined to be degraded by the proteasome; may modulate proteasome-mediated protein degradation (By similarity). Links CD47 to vimentin- containing intermediate filaments of the cytoskeleton. 

Protein Sequence MAENGESSGPPRPSRGPAAAPGAASPPAEPKIIKVTVKTPKEKEEFAVPENSTVQQFKEAISKRFKSQTD...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEECCCCHHHHHHHHHHHHHCCCHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
25PhosphoserinePGAASPPAE
CCCCCCCCC
30.77PhosphoELM
Link-
25PhosphoserinePGAASPPAE
CCCCCCCCC
30.77Phosphositeplus
Link-
25PhosphoserinePGAASPPAE
CCCCCCCCC
30.77SysPTM
Link-
25Phosphoserine.PGAASPPAE
CCCCCCCCC
30.77UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Phosphoproteomic analysis of the developing mouse brain.";
Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P.;
Mol. Cell. Proteomics 3:1093-1101(2004).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-25, AND MASSSPECTROMETRY.
"Qualitative and quantitative analyses of protein phosphorylation innaive and stimulated mouse synaptosomal preparations.";
Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F.,Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D.,Gerrits B., Panse C., Schlapbach R., Mansuy I.M.;
Mol. Cell. Proteomics 6:283-293(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-25, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures