Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  UBX domain-containing protein 7  

UniProtKB / Swiss-Prot ID :  UBXN7_HUMAN

Gene Name (Synonyms) : 
UBXN7, KIAA0794, UBXD7  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MAAHGGSAASSALKGLIQQFTTITGASESVGKHMLEACNNNLEMAVTMFLDGGGIAEEPSTSSASVSTVR...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
14Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SSALKGLIQ
51.92Phosphositeplus
Link-
84Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PIPQKQEIL
44.54Phosphositeplus
Link-
99Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FGAPKRRRP
58.99Phosphositeplus
Link-
99Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FGAPKRRRP
58.99SysPTM
Link-
99Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin).FGAPKRRRP
58.99UniProtKB
Link-
106PhosphoserineRPARSIFDG
29.70HPRD
Link-
109Caspase cleavage aspartic acidRSIFDGFRD
54.36Phosphositeplus
Link-
116PhosphothreonineRDFQTETIR
34.78Phosphositeplus
Link-
118PhosphothreonineFQTETIRQE
25.50Phosphositeplus
Link-
133Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GAIDKKLTT
43.50Phosphositeplus
Link-
134Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AIDKKLTTL
47.52Phosphositeplus
Link-
151Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DLMHKGSFE
42.14Phosphositeplus
Link-
194Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NEAVKNIIR
49.86Phosphositeplus
Link-
221Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IQFYKLGDF
47.48Phosphositeplus
Link-
268PhosphoserineLDGLSSSPP
34.01HPRD
Link-
269PhosphoserineDGLSSSPPK
52.48HPRD
Link-
278PhosphoserineKCARSESLI
17.01HPRD
Link-
278PhosphoserineKCARSESLI
17.01PhosphoELM
Link-
278PhosphoserineKCARSESLI
17.01Phosphositeplus
Link-
280PhosphoserineARSESLIDA
31.69PhosphoELM
Link-
280PhosphoserineARSESLIDA
31.69Phosphositeplus
Link-
280Phosphoserine.ARSESLIDA
31.69UniProtKB
Link-
285PhosphoserineLIDASEDSQ
37.88HPRD
Link-
285PhosphoserineLIDASEDSQ
37.88PhosphoELM
Link-
285PhosphoserineLIDASEDSQ
37.88Phosphositeplus
Link-
285Phosphoserine.LIDASEDSQ
37.88UniProtKB
Link-
288PhosphoserineASEDSQLEA
32.39HPRD
Link-
288PhosphoserineASEDSQLEA
32.39PhosphoELM
Link-
288PhosphoserineASEDSQLEA
32.39Phosphositeplus
Link-
288PhosphoserineASEDSQLEA
32.39SysPTM
Link-
288Phosphoserine.ASEDSQLEA
32.39UniProtKB
Link-
306PhosphothreonineHFDSTQTKQ
41.94HPRD
Link-
306PhosphothreonineHFDSTQTKQ
41.94Phosphositeplus
Link-
306Phosphothreonine.HFDSTQTKQ
41.94UniProtKB
Link-
400Caspase cleavage aspartic acidPEKADGVVE
62.58Phosphositeplus
Link
440Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LALVKHVQS
38.62Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-288, AND MASSSPECTROMETRY.
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions.";
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.;
Sci. Signal. 2:RA46-RA46(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-285 AND SER-288, ANDMASS SPECTROMETRY.
"Global phosphoproteome of HT-29 human colon adenocarcinoma cells.";
Kim J.-E., Tannenbaum S.R., White F.M.;
J. Proteome Res. 4:1339-1346(2005).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-280 AND SER-288, ANDMASS SPECTROMETRY.
"Quantitative phosphoproteome profiling of Wnt3a-mediated signalingnetwork: indicating the involvement of ribonucleoside-diphosphatereductase M2 subunit phosphorylation at residue serine 20 in canonicalWnt signal transduction.";
Tang L.-Y., Deng N., Wang L.-S., Dai J., Wang Z.-L., Jiang X.-S.,Li S.-J., Li L., Sheng Q.-H., Wu D.-Q., Li L., Zeng R.;
Mol. Cell. Proteomics 6:1952-1967(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-288, AND MASSSPECTROMETRY.
"ATM and ATR substrate analysis reveals extensive protein networksresponsive to DNA damage.";
Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III,Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N.,Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.;
Science 316:1160-1166(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-306, AND MASSSPECTROMETRY.
"Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column.";
Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y.;
Anal. Sci. 24:161-166(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-288, AND MASSSPECTROMETRY.
"Combining protein-based IMAC, peptide-based IMAC, and MudPIT forefficient phosphoproteomic analysis.";
Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D.,Yates J.R. III;
J. Proteome Res. 7:1346-1351(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-288, AND MASSSPECTROMETRY.
Ubiquitylation
ReferencePubMed
"Quantitative analysis of global ubiquitination in HeLa cells by massspectrometry.";
Meierhofer D., Wang X., Huang L., Kaiser P.;
J. Proteome Res. 7:4566-4576(2008).
Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-99, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures