Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ribonuclease UK114  

UniProtKB / Swiss-Prot ID :  UK114_HUMAN

Gene Name (Synonyms) : 
HRSP12, PSP  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Nucleus. Note=Mostly cytoplasmic but, in less differentiated cells occasionally nuclear. 

Protein Function :  Endoribonuclease responsible for the inhibition of the translation by cleaving mRNA. Inhibits cell-free protein synthesis. Cleaves phosphodiester bonds only in single-stranded RNA (By similarity). 

Protein Sequence MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAG...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCHHHHHCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylserine---MSSLIR
---CCCCCC
33.57HPRD
Link
2Phosphoserine---MSSLIR
---CCCCCC
33.57HPRD
Link
2Phosphoserine---MSSLIR
---CCCCCC
33.57Phosphositeplus
Link
21PhosphotyrosineAIGPYSQAV
CCCCCHHHH
14.27Phosphositeplus
Link
101N6-acetyllysineKQYFKSNFP
HHHCCCCCC
39.29HPRD
Link
101N6-acetyllysineKQYFKSNFP
HHHCCCCCC
39.29Phosphositeplus
Link
101N6-acetyllysine.KQYFKSNFP
HHHCCCCCC
39.29UniProtKB
Link
110PhosphotyrosineARAAYQVAA
EEEEEEEEE
11.53Phosphositeplus
Link
136PhosphoserineLTTASL
CCCCCC
32.30HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-101, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures