Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Uridine 5'-monophosphate synthase  

UniProtKB / Swiss-Prot ID :  UMPS_HUMAN

Gene Name (Synonyms) : 
UMPS OK/SW-cl.21  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDT...
Predicted Secondary Structure  -
Protein Variant
LocationDescription
30S -> G (in dbSNP:rs17843776). VAR_020614
96R -> G (in ORAC1). VAR_006807
109V -> G (in ORAC1). VAR_006808
213G -> A (in dbSNP:rs1801019). VAR_006809
429G -> R (in ORAC1). VAR_006810
446I -> V (in dbSNP:rs3772809). VAR_020615
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAVARA
---
12.04UniProtKB
Link-
22Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VQAFKFGDF
51.99Phosphositeplus
Link-
29Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DFVLKSGLS
36.86Phosphositeplus
Link-
37PhosphotyrosineSSPIYIDLR
7.55HPRD
Link-
37PhosphotyrosineSSPIYIDLR
7.55PhosphoELM
Link-
37PhosphotyrosineSSPIYIDLR
7.55Phosphositeplus
Link-
37Phosphotyrosine.SSPIYIDLR
7.55UniProtKB
Link-
162N6-acetyllysineGGKDKLQAH
46.08HPRD
Link-
162N6-acetyllysineGGKDKLQAH
46.08Phosphositeplus
Link-
162N6-acetyllysine.GGKDKLQAH
46.08UniProtKB
Link-
174S-nitrosocysteineLHSVCTLSK
3.38dbSNO
Link-
214PhosphoserineNHNGSPLSI
28.16HPRD
Link-
214PhosphoserineNHNGSPLSI
28.16PhosphoELM
Link-
214PhosphoserineNHNGSPLSI
28.16Phosphositeplus
Link-
214PhosphoserineNHNGSPLSI
28.16SysPTM
Link-
214Phosphoserine.NHNGSPLSI
28.16UniProtKB
Link-
219Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PLSIKEAPK
44.43Phosphositeplus
Link-
314Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FEDRKFADI
58.17Phosphositeplus
Link
323Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GNTVKKQYE
31.92Phosphositeplus
Link
324Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NTVKKQYEG
54.50Phosphositeplus
Link
409Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RVSMKPEFL
33.61Phosphositeplus
Link
432PhosphotyrosineLGQQYNSPQ
15.10Phosphositeplus
Link
441Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EVIGKRGSD
42.32Phosphositeplus
Link
444PhosphoserineGKRGSDIII
29.66HPRD
Link
444PhosphoserineGKRGSDIII
29.66Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
OMIM disease
258900Orotic aciduria 1 (ORAC1)
Drug Reference
DrugBank
DB00544Fluorouracil
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-162, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer.";
Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.;
Cell 131:1190-1203(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-37, AND MASSSPECTROMETRY.
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-214, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures