Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Uridine phosphorylase 1  

UniProtKB / Swiss-Prot ID :  UPP1_HUMAN

Gene Name (Synonyms) : 
UPP1, UP  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1- phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. 

Protein Sequence MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIR...
Predicted Secondary Structure CCCCCCCHHHHHCCCCCEEEEECCCHHHCCCCEEEEECCCCCCCCCCCCCCCEEEEEECCCHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
35PhosphotyrosineEDILYHFNL
CCEEEEECC
12.52Phosphositeplus
Link
61PhosphoserineCVGGSPSRM
EECCCHHHH
17.49HPRD
Link
61PhosphoserineCVGGSPSRM
EECCCHHHH
17.49Phosphositeplus
Link
232Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TEKDKQAYL
HHHHHHHHH
48.14Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
VIME_HUMANin vitro
in vivo
HPRD:08932HPRD11278417
AICDA_HUMANENSP00000330032STRING
PNPH_HUMANENSP00000330032STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00544Fluorouracil
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures