Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  U3 small nucleolar RNA-associated protein 15 homolog  

UniProtKB / Swiss-Prot ID :  UTP15_HUMAN

Gene Name (Synonyms) : 
UTP15  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus, nucleolus. 

Protein Function :  Involved in nucleolar processing of pre-18S ribosomal RNA (By similarity). 

Protein Sequence MAGYKPVAIQTYPILGEKITQDTLYWNNYKTPVQIKEFGAVSKVDFSPQPPYNYAVTASSRIHIYGRYSQ...
Predicted Secondary Structure CCCCCCCEECCCCEECCCCCCCEEEECCCCCEEEECCCCCEEEEEECCCCCEEEEEECCCEEEEEECCCC...
Protein Variant
LocationDescription
228Y -> H (in dbSNP:rs16870608). VAR_057621
332R -> S (in dbSNP:rs35313343). VAR_057622
483T -> P (in dbSNP:rs35898225). VAR_057623
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAGYKP
---CCCCCC
29.98UniProtKB
Link-
36Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PVQIKEFGA
EEEECCCCC
29.87Phosphositeplus
Link-
84PhosphotyrosineKDTAYCATF
CCCEEEEEE
5.68HPRD
Link-
155Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IPNSKEILT
CCCCEEEEE
56.25Phosphositeplus
Link-
393PhosphothreonineTPEITVSII
CCEEEEEEE
13.41HPRD
Link-
398Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VSIIKELNR
EEEEECCCC
55.25Phosphositeplus
Link-
472Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GLVEKEIDY
HHHHHHCCH
53.11Phosphositeplus
Link-
497Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TMRRKEGTS
CCCCCCCCC
50.56Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures