Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  vacuole-related protein 17  

UniProtKB / Swiss-Prot ID :  VAC17_YEAST

Gene Name (Synonyms) : 
VAC17 YCL063W YCL63W/YCL62W  

Species :  Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). 

Subcellular Localization :  Vacuole membrane; Peripheral membrane protein; Cytoplasmic side. 

Protein Function :  Vacuole-specific MYO2 receptor required for vacuole inheritance. Binds simultaneously to MYO2 and to VAC8, a vacuolar membrane protein, forming a transport complex which moves the attached vacuole membrane along actin cables into the bud. Once the vacuole arrives in the bud, VAC17 is degraded, depositing the vacuole in its correct location. 

Protein Sequence MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMSQLNSLYVRSESVR...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
119Phosphoserine.APNDSPQSQ
31.32UniProtKB
Link-
149Phosphothreonine.LCMVTPSKP
8.58UniProtKB
Link-
178Phosphoserine.SLPCSPKKQ
37.50UniProtKB
Link-
248Phosphothreonine.PNISTPPHV
36.72UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"The cyclin-dependent kinase Cdk1 directly regulates vacuoleinheritance.";
Peng Y., Weisman L.S.;
Dev. Cell 15:478-485(2008).
Cited for: PHOSPHORYLATION AT SER-119; THR-149; SER-178 AND THR-248, INTERACTIONWITH MYO2, FUNCTION, AND MUTAGENESIS OF SER-119; THR-149; SER-178;PHE-225 AND THR-248.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures