Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Vitamin K-dependent gamma-carboxylase  

UniProtKB / Swiss-Prot ID :  VKGC_MOUSE

Gene Name (Synonyms) : 
Ggcx  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Endoplasmic reticulum membrane; Multi-pass membrane protein (By similarity). 

Protein Function :  Mediates the vitamin K-dependent carboxylation of glutamate residues to calcium-binding gamma-carboxyglutamate (Gla) residues with the concomitant conversion of the reduced hydroquinone form of vitamin K to vitamin K epoxide. 

Transmembrane Topology (topPTM) : VKGC_MOUSE 

Protein Sequence MAVHRGSALVAPASDKVQKNKSAQTSGLKQGSRMEKILGFEWTDLSSWQSVVTLLNKPTDPANLAVFRFL...
Predicted Secondary Structure CCCCCCCCCCCCCCHHHHCCCHHHHCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures