Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Outer capsid protein VP4  

UniProtKB / Swiss-Prot ID :  VP4_ROTP3

Gene Name (Synonyms) :  -
 

Species :  Rotavirus A (isolate Pig/Australia/CRW-8/1987G3-P9[7]-I5-Rx-Cx-Mx-Ax-Nx-Tx-Ex-Hx) (RV-A). 

Subcellular Localization :  Outer capsid protein VP4: Virion. Host rough endoplasmic reticulum (Potential). Note=Immature double-layered particles assembled in the cytoplasm bud across the membrane of the endoplasmic reticulum, acquiring during this process a transient lipid membra 

Protein Function :  Spike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virulence. Rotavirus entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. According to the considered strain, VP4 seems to essentially target sialic acid and/or the integrin heterodimer ITGA2/ITGB1 (By similarity). Outer capsid protein VP5*: forms the spike "foot" and "body". Acts as a membrane permeabilization protein that mediates release of viral particles from endosomal compartments into the cytoplasm. In integrin-dependent strains, VP5* targets the integrin heterodimer ITGA2/ITGB1 for cell attachment (By similarity). VP8* forms the head of the spikes. It is the viral hemagglutinin and an important target of neutralizing antibodies. In sialic acid-dependent strains, VP8* binds to host cell sialic acid, most probably a ganglioside, providing the initial contact (By similarity). 

Protein Sequence MASLIYRQLLTNSYTVNLSDEIQEIGSAKSKNVTINPGPFAQTGYAPVNWGAGETNDSTTVEPLLDGPYR...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
17N-linked (GlcNAc...); by hostSYTVNLSDE
26.48UniProtKB
Link-
56N-linked (GlcNAc...); by hostAGETNDSTT
36.61UniProtKB
Link-
132N-linked (GlcNAc...); by hostLSVENTSQT
42.76UniProtKB
Link
178N-linked (GlcNAc...); by hostIYTYNGTTP
33.27UniProtKB
Link
183N-linked (GlcNAc...); by hostGTTPNATTG
48.07UniProtKB
Link
198N-linked (GlcNAc...); by hostYDTVNMTLF
21.58UniProtKB
Link
325N-linked (GlcNAc...); by hostNGVNNFSYN
25.49UniProtKB
Link-
670N-linked (GlcNAc...); by hostKFIPNRTYR
44.07UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures