Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  WASH complex subunit 7  

UniProtKB / Swiss-Prot ID :  WASH7_HUMAN

Gene Name (Synonyms) : 
KIAA1033  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Component of the WASH complex, a complex present at the surface of endosomes that recruits and activates the Arp2/3 complex to induce actin polymerization. The WASH complex plays a key role in the fission of tubules that serve as transport intermediates during endosome sorting (By similarity). 

Protein Sequence MAVETLSPDWEFDRVDDGSQKIHAEVQLKNYGKFLEEYTSQLRRIEDALDDSIGDVWDFNLDPIALKLLP...
Predicted Secondary Structure  -
Protein Variant
LocationDescription
323V -> L (in dbSNP:rs34434425). VAR_031417
599T -> S (in dbSNP:rs1345092). VAR_057825
901V -> I (in dbSNP:rs1663564). VAR_031418
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
7PhosphoserineVETLSPDWE
28.38HPRD
Link-
7PhosphoserineVETLSPDWE
28.38Phosphositeplus
Link-
7Phosphoserine.VETLSPDWE
28.38UniProtKB
Link-
29Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EVQLKNYGK
30.91Phosphositeplus
Link-
119PhosphotyrosineGLLFYGEGA
17.78Phosphositeplus
Link-
155PhosphotyrosineVTRCYEVVM
14.41Phosphositeplus
Link-
169PhosphotyrosineLAALYISNK
9.51Phosphositeplus
Link-
233Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)HNPSKFGIQ
49.20Phosphositeplus
Link-
302Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NVEAKLGEP
43.44Phosphositeplus
Link-
394Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FLQQKAQSL
35.12Phosphositeplus
Link-
422Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SILSKEQRM
55.19Phosphositeplus
Link-
461PhosphotyrosineTMNLYMSMQ
5.11Phosphositeplus
Link-
553Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GPSTKQRRL
46.26Phosphositeplus
Link-
573Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MKTFKDEEL
70.26Phosphositeplus
Link-
585Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QVVMKKLDL
38.28Phosphositeplus
Link-
813Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TSNNKHLNT
54.44Phosphositeplus
Link-
968Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EETLKAARH
47.63Phosphositeplus
Link-
1089Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RAVAKQQNV
45.90Phosphositeplus
Link-
1157PhosphoserineETKTSNGDL
40.13HPRD
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
OMIM disease
615817Mental retardation, autosomal recessive 43 (MRT43)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Kinase-selective enrichment enables quantitative phosphoproteomics ofthe kinome across the cell cycle.";
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,Greff Z., Keri G., Stemmann O., Mann M.;
Mol. Cell 31:438-448(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-7, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures