Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ribosome biogenesis protein WDR12  

UniProtKB / Swiss-Prot ID :  WDR12_HUMAN

Gene Name (Synonyms) : 
WDR12  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus, nucleolus. Nucleus, nucleoplasm. 

Protein Function :  Component of the PeBoW complex, which is required for maturation of 28S and 5.8S ribosomal RNAs and formation of the 60S ribosome. 

Protein Sequence MAQLQTRFYTDNKKYAVDDVPFSIPAASEIADLSNIINKLLKDKNEFHKHVEFDFLIKGQFLRMPLDKHM...
Predicted Secondary Structure CCEEEEEEECCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEEEECCCCEEEEEECCCEE...
Protein Variant
LocationDescription
72M -> V. VAR_012863
75I -> V (in dbSNP:rs35212307). VAR_054888
89Y -> C. VAR_012864
286E -> G. VAR_012865
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAQLQT
---CCEEEE
20.84UniProtKB
Link-
203Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GSGTKFCSG
CCCCEEEEE
48.15Phosphositeplus
Link-
221PhosphothreonineSTVPTDEED
ECCCCCCCC
52.27Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
NOTC1_HUMANin vivoHPRD:18295HPRD11827460
BOP1_HUMANENSP00000261015STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures