Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Zinc finger protein 622  

UniProtKB / Swiss-Prot ID :  ZN622_HUMAN

Gene Name (Synonyms) : 
ZNF622, ZPR9  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Nucleus. 

Protein Function :  May behave as an activator of the bound transcription factor, MYBL2, and be involved in embryonic development. 

Protein Sequence MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCT...
Predicted Secondary Structure CCEEEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
75Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VCSKKFASF
EEEEECCCH
29.84Phosphositeplus
Link-
116Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KNLEKGLGV
HHHHHHHCH
63.70Phosphositeplus
Link-
125Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DSVDKDAMN
HHHHHHHHH
45.27Phosphositeplus
Link-
163PhosphothreonineVAVGTGGRG
CHHHHCCCC
29.84Phosphositeplus
Link-
276PhosphoserineTKDHSFFIP
HHHHCEECC
31.80HPRD
Link-
276PhosphoserineTKDHSFFIP
HHHHCEECC
31.80PhosphoELM
Link-
276PhosphoserineTKDHSFFIP
HHHHCEECC
31.80Phosphositeplus
Link-
276PhosphoserineTKDHSFFIP
HHHHCEECC
31.80SysPTM
Link-
276Phosphoserine.TKDHSFFIP
HHHHCEECC
31.80UniProtKB
Link-
284PhosphotyrosinePDIEYLSDI
CCHHHHHHH
16.31Phosphositeplus
Link-
314PhosphoserineEKGKSFYST
CCCCCCCHH
37.78Phosphositeplus
Link-
318PhosphothreonineSFYSTEAVQ
CCCHHHHHH
19.31Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
MYBB_HUMANin vivo
yeast 2-hybrid
HPRD:12278HPRD12645566
MELK_HUMANin vivo
yeast 2-hybrid
HPRD:12278HPRD11802789
ZN622_HUMANin vivo
yeast 2-hybrid
HPRD:12278HPRD11802789
MYBB_HUMANENSP00000310042STRING
STK38_HUMANENSP00000310042STRING
MELK_HUMANENSP00000310042STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-276, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures