Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Centromere/kinetochore protein zw10 homolog  

UniProtKB / Swiss-Prot ID :  ZW10_HUMAN

Gene Name (Synonyms) : 
ZW10  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Endoplasmic reticulum membrane; Peripheral membrane protein. Chromosome, centromere, kinetochore. Cytoplasm, cytoskeleton, spindle. Note=Dynamic pattern of localization during the cell cycle. In most cells at interphase, present diffusely in t 

Protein Function :  Essential component of the mitotic checkpoint, which prevents cells from prematurely exiting mitosis. Required for the assembly of the dynein-dynactin and MAD1-MAD2 complexes onto kinetochores. Involved in regulation of membrane traffic between the Golgi and the endoplasmic reticulum. 

Protein Sequence MASFVTEVLAHSGRLEKEDLGTRISRLTRRVEEIKGEVCNMISKKYSEFLPSMQSAQGLITQVDKLSEDI...
Predicted Secondary Structure CCHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH...
Protein Variant
LocationDescription
77I -> M (in dbSNP:rs2271796). VAR_053537
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MASFVT
---CCHHHH
16.21UniProtKB
Link-
12PhosphoserineVLAHSGRLE
HHHCCCCCC
21.72Phosphositeplus
Link-
22PhosphothreonineEDLGTRISR
HHHHHHHHH
31.93Phosphositeplus
Link-
74Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IDLLKSRIE
HHHHHHHHC
45.01Phosphositeplus
Link-
96Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FTDLKQQLE
HHHHHHHHH
38.52Phosphositeplus
Link-
133PhosphothreonineKKYVTGAQR
CCEEEHHHH
24.57HPRD
Link-
133PhosphothreonineKKYVTGAQR
CCEEEHHHH
24.57Phosphositeplus
Link-
386PhosphothreonineKGDTTDLLK
CCCHHHHHH
29.41HPRD
Link-
386PhosphothreonineKGDTTDLLK
CCCHHHHHH
29.41Phosphositeplus
Link-
438PhosphothreoninePELPTPDED
CCCCCCCCC
56.87HPRD
Link-
438PhosphothreoninePELPTPDED
CCCCCCCCC
56.87PhosphoELM
Link-
438PhosphothreoninePELPTPDED
CCCCCCCCC
56.87Phosphositeplus
Link-
438PhosphothreoninePELPTPDED
CCCCCCCCC
56.87SysPTM
Link-
438Phosphothreonine.PELPTPDED
CCCCCCCCC
56.87UniProtKB
Link-
624Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SAASKAVRQ
HHHHHHHHH
46.29Phosphositeplus
Link-
662PhosphoserineNTAISEVIG
HHHHHHHHH
24.28HPRD
Link-
777N6-acetyllysineAALAKIK
HHHHCCC
52.45HPRD
Link-
777N6-acetyllysineAALAKIK
HHHHCCC
52.45Phosphositeplus
Link-
777N6-acetyllysine.AALAKIK
HHHHCCC
52.45UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
RINT1_HUMANphysical interactionEBI-1001216
intact15824131
ZWILC_HUMANphysical interactionEBI-1001216
intact15824131
CS025_HUMANphysical interactionEBI-1001216
intact15824131
KNTC1_HUMANphysical interactionEBI-1001216
intact15824131
BUB1B_HUMANcolocalizationEBI-1001465
intact15824131
BUB1_HUMANcolocalizationEBI-1001434
intact15824131
MD1L1_HUMANcolocalizationEBI-1001430
intact15824131
ZWINT_HUMANcolocalization
physical interaction
physical interaction
physical interaction
colocalization
colocalization
EBI-1001292
EBI-1001272
EBI-1
intact15824131
15824131
16732327
16732327
16732327
16732327
NDC80_HUMANphysical interaction
physical interaction
physical interaction
colocalization
EBI-1001549
EBI-1001525
EBI-1
intact16732327
16732327
16732327
16732327
KNTC1_HUMANENSP00000200135STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-777, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Phosphoproteome analysis of the human mitotic spindle.";
Nousiainen M., Sillje H.H.W., Sauer G., Nigg E.A., Koerner R.;
Proc. Natl. Acad. Sci. U.S.A. 103:5391-5396(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-438, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures