Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Centromere/kinetochore protein zw10 homolog  

UniProtKB / Swiss-Prot ID :  ZW10_PONAB

Gene Name (Synonyms) : 
ZW10  

Species :  Pongo abelii (Sumatran orangutan). 

Subcellular Localization :  Cytoplasm (By similarity). Endoplasmic reticulum membrane; Peripheral membrane protein (By similarity). Chromosome, centromere, kinetochore (By similarity). Cytoplasm, cytoskeleton, spindle (By similarity). Note=Dynamic pattern of localization during the 

Protein Function :  Essential component of the mitotic checkpoint, which prevents cells from prematurely exiting mitosis. Required for the assembly of the dynein-dynactin and MAD1-MAD2 complexes onto kinetochores. Involved in regulation of membrane traffic between the Golgi and the endoplasmic reticulum (By similarity). 

Protein Sequence MASFVTEVLAHSGRLEKEDLGARISRLTRRVEEIKGEVCNMISKKYSEFLPSMQSAQGLITQVDKLSEDI...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures